THÈse pour obtenir le grade de








télécharger 0.97 Mb.
titreTHÈse pour obtenir le grade de
page9/20
date de publication12.08.2018
taille0.97 Mb.
typeThèse
l.21-bal.com > comptabilité > Thèse
1   ...   5   6   7   8   9   10   11   12   ...   20

IV-ETUDE DE DYNAMIQUE
D’un point de vue physico-chimique une protéine est un polymère se repliant en une structure tridimensionnelle bien définie en moyenne, non périodique, et maintenue par de interactions faibles non covalentes. Cette structure peut subir de larges fluctuations et se déplacer dans différentes conformations. Les mouvements induits couvrent des échelles de temps très variées (allant de 10-15 à 103 s). Les spins nucléaires sont sensibles aux mouvements des autres noyaux situés à quelques Å ce qui a pour effet d’influencer leur relaxation. L’étude de ce phénomène de relaxation permet d’obtenir des informations de dynamique de la protéine et passe par la mesure RMN de trois paramètres de relaxation : le vitesse de relaxation longitudinale R1, la vitesse de relaxation tranversale R2 et le paramètre de relaxation croisée nOe.
La dynamique interne des protéines est étudiée essentiellement à partir de la relaxation des noyaux d’azote 15N ou de carbone 13C. Pour les deux systèmes de spins 15N et 13C, il existe une interaction dipolaire (DD) avec le proton et une anisotropie du déplacement chimique (CSA pour chemical shift anisotropy). Ces deux phénomènes créent un champ magnétique local sur les noyaux qui va provoquer la relaxation des systèmes excités. Ce champ magnétique local varie en fonction de l’orientation de la liaison H-X par rapport au champ magnétique statique. Cette fluctuation est due à la réorientation de la protéine sur elle-même. L’évolution temporelle de l’orientation de la liaison H-X, donc du champ magnétique local, est décrite, mathématiquement, par une fonction de corrélation dont la transformée de Fourier donne la fonction de densité spectrale J(ω), qui permet une description dans le domaine des fréquences du phénomène de relaxation.
La mesure de ces paramètres de relaxation permet d’extraire les paramètres de dynamique tel que le temps de corrélation globale (τc), le temps de corrélation des mouvements internes (τi), et les paramètres d’ordre S2. Le temps de corrélation globale (τc) est le temps moyen dont une molécule en solution a besoin pour accomplir une rotation d’un radian (dans la gamme des ns). Le temps de corrélation local (τi) (de la ps à la ns) a la même signification que τc mais concerne un vecteur (liaison HN-N par exemple). Les paramètres d’ordre (S2) donnent une mesure de l’amplitude des mouvements internes des vecteurs étudiés. Plus sa valeur tend vers 1, plus le mouvement de la liaison est restreint.


Figure 16 : Schéma très simplifié du phénomène de relaxation

Chapitre III


Production et attribution de la protéine SufA

La production d’une protéine soluble et stable dans le temps est une étape primordiale Cependant cette étape est le plus souvent consommatrice de temps de d’énergie. Les progrès des outils de biologie moléculaire, ainsi que le développement incessant des techniques de purification, ont grandement facilité la réalisation de tel projet. L’obtention d’un échantillon protéique dans les conditions requises pour une étude par RMN, est suivie de l’étape d’attribution. Ces deux étapes constituent la porte d’entrée de l’étude structurale par RMN qui nécessite ensuite l’extraction de contraintes structurales RMN qui sont introduites dans le calcul de structure. Notons que pour pouvoir extraire les données structurales et dynamiques par RMN, il faut connaître les déplacements chimiques de tous les atomes de la protéine. En cela, l’étape d’attribution est fondamentale pour la réussite du projet.

I-PRÉPARATION DE L’ÉCHANTILLON DE LA PROTÉINE SufA
La protéine SufA, possédant une étiquette Histidine (tag) en position C-terminale, a été caractérisée biochimiquement et spectroscopiquement dans le cadre d’étude au laboratoire. Le protocole de production de la protéine SufA, présenté dans le chapitre « matériels et méthodes » de cette thèse, était donc déjà établi pour ces recherches. La protéine, identifiée comme étant un dimère, imposait de réaliser un double marquage 15N, 13C pour les raisons que nous avons indiquées dans le chapitre précédant. Toutefois, afin de contrôler la faisabilité de l’étude par RMN, nous avons tout d’abord effectué un simple marquage 15N uniforme de la protéine SufA. D’autre part, le protocole de production de la protéine marquée a été adapté pour le marquage, et est identique pour les deux types de marquages.

I.1-Résultats de production de la protéine SufA
1) L’analyse par SDS-PAGE des cellules surexprimant SufA a montré une expression importante d’un polypeptide d’environ 14 kDa, absent dans les cellules non induites.



90 kDa

60 Kda

40 kDa

30 kDa
20 kDa
14 kDa

P1

P1 à 6

SufA
2) La pureté de la protéine après colonne NiNTA puis colonne Superdex75, analysée par SDS-PAGE (Figure 2), montre que SufA est pure.

Figure 2: Gel d'électrophorèse 15 % - analyse de la purification après Sdx-75

Puits 1 : marqueurs de poids moléculaires - Puits 1 à 6 : fractions de purification

3) Bilan de la purification de la SufA d’E. coli à partir de 3 litres de culture :





Quantité (mg) de protéines

Rendement a (%)

Superdex 75


22

15


(a) Rendement = [Q(mg) protéines avant purification / Q(mg) protéines après purification] x 100

II-CARACTÉRISATION PAR RMN DE SufA

Il est intéressant, avant de démarrer une analyse RMN, d’effectuer une analyse « bioinformatique » de la protéine d’intérêt. En ayant recours à des logiciels de prédiction de structures secondaires, et/ou en effectuant des alignements de séquences afin de trouver des protéines homologues dont la structure est connue. On peut ainsi obtenir des informations préliminaires quant à la structuration de la protéine. En ce qui concerne la protéine SufA, nous avions connaissance de la structure de la protéine homologue IscA sous la forme apo, obtenue par radiocristallographie [cxxxii].


II.1-Caractéristiques de SufA d’E. coli
La caractérisation de la protéine SufA a été réalisée en utilisant le serveur de biologie moléculaire « Expasy ». On extrait un certain nombre de caractéristiques physico-chimiques de la protéine par l’utilisation d’outils d’analyse (« ProtParam ») de la séquence primaire disponibles sur le site. internet : http://www.expasy.org/cgi-bin/protparam.

Séquence :
MDMHSGTFNPQDFAWQGLTLTPAAAIHIRELVAKQPGMVGVRLGVKQTGCAGFGYVLDSV

SEPDKDDLLFEHDGAKLFVPLQAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESF

GVLEHHHHHH

Nombre d’acides aminés : 122

Masse moléculaire : 13300.1 Da (MExpasy)

pI théorique (point isoélectrique) : 4.85
Composition en acides aminés :
Ala (A) 9 7.4%

Arg (R) 3 2.5%

Asn (N) 4 3.3%

Asp (D) 9 7.4%

Cys (C) 3 2.5%

Gln (Q) 7 5.7%

Glu (E) 7 5.7%

Gly (G) 14 11.5%

His (H) 4 3.3%

Ile (I) 4 3.3%

Leu (L) 10 8.2%

Lys (K) 6 4.9%

Met (M) 4 3.3%

Phe (F) 10 8.2%

Pro (P) 7 5.7%

Ser (S) 4 3.3%

Thr (T) 5 4.1%

Trp (W) 1 0.8%

Tyr (Y) 1 0.8%

Val (V) 10 8.2%
De cette analyse on en déduit que : la protéine SufA est constituée de 31.2% de chaînes latérales contenant des groupes méthyles qui sont susceptibles de former une ou plusieurs zones hydrophobes et de 13.1% de residus aromatiques.

II.2-Prédiction de structures secondaires de SufA
La prédiction de structure secondaire a été réalisée à l’aide du programme PHDsec (http://cubic.bioc.columbia.edu/predictprotein/submit_def.html).

D’après la prédiction de structure secondaires, plus de 40% des résidus de la protéine sont impliqués dans un élément de structure secondaire, avec environ 25% de brins β et 15% d’hélices .

On constate sur la Figure 1 ci-dessous que les structures secondaires issues de la prédiction de structure de SufA sont identiques à celles d’IscA de structure connue. Comme les deux protéines présentent une forte identité de séquence, on peut supposer que la structure de SufA sera très proche de celle d’IscA.

SufA, 18 LTLTPAAAIHIRELVAKQPGMVGVRLGVKQTGCAGFGYVLDSVSEPDKDDLLFEHDGAKL

IscA, 3 ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEDKGVKV

** ** * * **** ** * *** * ** * ** * *

PROF_sec EEEE HHHHHHHHHHHH EEEEEEE EEEEEEEE EEEE EEE

SufA, 78 FVPLQAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESFGV

IscA, 63 VVDGKSMQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV

* * * *** *** **** *** ** ******** *
PROF_sec EEE EEE EEE EEEEEEE EEEEE

Figure 1 : Alignement de séquences et prédiction de structures secondaires des protéine SufA et IscA d’E. Coli (48.6% identité pour 105 residus)

E = feuillet β et H = hélice α
II.3-ÉCHANTILLON RMN
Les échantillons préparés pour l’étude de SufA ont une concentration de l’ordre du millimolaire (mM) et sont stables dans le temps (plusieurs semaines à 4°C). Ces caractéristiques se prêtent donc bien à l’étude RMN. L’échantillon est dans un tampon phosphate 50 mM de pH égal à 6.8, en présence de dithiorétiol (DTT) de concentration 10 mM afin d’éviter la présence d’oligomères par formation de ponts disulfures. On ajoute, d’autre part, un coktail antiprotéases de type COMPLETETM (Boehringer) pour éviter la protéolyse de la protéine, ainsi que de 10 % (du volume final) de D2O nécessaire au verrouillage du signal RMN. On injecte ensuite un gaz inerte, de l’argon, dans le tube RMN où se trouve l’échantillon de protéine, ainsi préparée, de 450 μL. Le tube RMN est alors scellé afin de protéger l’échantillon (oxygène, contaminants,…).



Échantillon

15N

15N/13C

Concentration

1 mM

1mM

Volume

450

450

D2O stérile

10%

10%

Tampon

50 mM phosphate, pH = 6.8

50 mM phosphate, pH = 6.8

Antiprotéases

Oui

Oui

DTT

10 mM

10 mM
1   ...   5   6   7   8   9   10   11   12   ...   20

similaire:

THÈse pour obtenir le grade de iconTHÈse pour obtenir le grade de Docteur de l’Université Paris 8

THÈse pour obtenir le grade de iconThèse pour obtenir le grade de docteur de l’Université Paris I panthéon-Sorbonne
«L’Université n’entend donner aucune approbation ni improbation aux opinions émises dans ce document. Ces opinions doivent être considérées...

THÈse pour obtenir le grade de iconThèse pour obtenir le titre de

THÈse pour obtenir le grade de iconTHÈse pour l’obtention du grade de
«sur le terrain», pour ce qu’elles ont bien voulu partager avec moi. La part d’elles-mêmes qu’elles m’ont ainsi laissée constitue...

THÈse pour obtenir le grade de iconPpcr : 6 questions pour comprendre la nouvelle donne pour les territoriaux
«La mécanique d’avancement de grade annoncée est assez rigide pour la catégorie a car elle valorise, pour le 3e grade dit “à accès...

THÈse pour obtenir le grade de iconDécret n° 2014-1587 du 23 décembre 2014 modifiant le décret n° 2006-227...
Ii. Les fonctionnaires de catégorie c relevant d’un grade doté de l’échelle 5 de rémunération qui sont promus dans le grade doté...

THÈse pour obtenir le grade de iconTextes de reference pour le grade d’attache

THÈse pour obtenir le grade de iconProgramme de l’épreuve de l’examen professionnel pour l’accès au grade de sapeur de 1

THÈse pour obtenir le grade de iconThèse soutenue publiquement par Sang-Ha suh le 10 Juillet 2006
«avec projection», de cette thèse aux membres du Conseil scientifique et à leurs expliquer pourquoi cette thèse ne devait pas être...

THÈse pour obtenir le grade de iconEchangeur de chaleur à courants croisés
«en U» nous permet d’obtenir une pression. Et à partir de ces pressions et du théorème de Torricelli, nous pouvons obtenir la vitesse...








Tous droits réservés. Copyright © 2016
contacts
l.21-bal.com